PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID mrna16287.1-v1.0-hybrid
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
Family MYB
Protein Properties Length: 350aa    MW: 38797.6 Da    PI: 6.1611
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
mrna16287.1-v1.0-hybridgenomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding59.38.5e-191461148
                             TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
          Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                             +g+WT+eEd++l ++++++G g+W++ ++  g++R++k+c++rw +yl
  mrna16287.1-v1.0-hybrid 14 KGPWTPEEDQKLMNYIQKHGHGSWRALPKLAGLNRCGKSCRLRWTNYL 61
                             79********************************************97 PP

2Myb_DNA-binding55.81e-1767112148
                              TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
          Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                              rg++++eE++ +++++  lG++ W++Ia++++ gRt++++k++w+++l
  mrna16287.1-v1.0-hybrid  67 RGKFSQEEEQTILNLHSILGNK-WSAIASHLP-GRTDNEIKNFWNTHL 112
                              89********************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.6E-27564IPR009057Homeodomain-like
PROSITE profilePS5129419.129961IPR017930Myb domain
SuperFamilySSF466891.45E-3211108IPR009057Homeodomain-like
SMARTSM007174.8E-151363IPR001005SANT/Myb domain
PfamPF002497.6E-181461IPR001005SANT/Myb domain
CDDcd001673.55E-121661No hitNo description
PROSITE profilePS5129426.74462116IPR017930Myb domain
Gene3DG3DSA:1.10.10.605.4E-2865117IPR009057Homeodomain-like
SMARTSM007173.6E-1766114IPR001005SANT/Myb domain
PfamPF002491.8E-1667112IPR001005SANT/Myb domain
CDDcd001677.49E-1369112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009733Biological Processresponse to auxin
GO:0009737Biological Processresponse to abscisic acid
GO:0009751Biological Processresponse to salicylic acid
GO:0003677Molecular FunctionDNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009005anatomyroot
PO:0007134developmental stagesporophyte vegetative stage
Sequence ? help Back to Top
Protein Sequence    Length: 350 aa     Download sequence    Send to blast
MGRSPCCDDS GLKKGPWTPE EDQKLMNYIQ KHGHGSWRAL PKLAGLNRCG KSCRLRWTNY  60
LRPDIKRGKF SQEEEQTILN LHSILGNKWS AIASHLPGRT DNEIKNFWNT HLKKKLIQMG  120
FDPMTHRPRT DIFSSLPHLL ALVNLKELID QGSSQASWDE QALRLQAEAA QMAKIQYLQY  180
LIQPQVSTSN NLSDFTDIET IGLLNSLCSS IKDVNPVFGS SRLETSAQYL GSSSVQDSIP  240
FSPLPDLQIV PSSAYQKDMI INQAQDQFTV LSQMDNSPNN VSWNIPSSSN TSTPSPPPLA  300
VPPVTETSTS NNNMGDTCST TTSSYGGVAT NSVWSDLLLE DYPFFNEIS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A5e-31121165108B-MYB
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00180DAPTransfer from AT1G34670Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004288189.10.0PREDICTED: transcription factor MYB28-like
TrEMBLM5W5261e-174M5W526_PRUPE; Uncharacterized protein
STRINGPOPTR_0007s05360.11e-144(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF40234172
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G34670.11e-104myb domain protein 93